PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG465300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 391aa    MW: 41306 Da    PI: 7.9983
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG465300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-25121165145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Pavir.1KG465300.1.p 121 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 165
                          79****************************************997 PP

2QLQ56.39.9e-206095237
                  QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                         +FT+aQ ++L++Q+l+yKyL+a++ vPp+L+++i++
  Pavir.1KG465300.1.p 60 PFTPAQYEELEQQALIYKYLVAGVAVPPDLVVPIRR 95
                         9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.8E-115995IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.7286095IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.7E-136094IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486121165IPR014977WRC domain
PfamPF088794.0E-21122164IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAMPYASLSP AGADHRSSPA TASLLPFCRA TPLSVAPASG DGGPAEDAPV GARWAARPVP  60
FTPAQYEELE QQALIYKYLV AGVAVPPDLV VPIRRGLDAF ATRFYGHPTL GYGSYFGKKL  120
DPEPGRCRRT DGKKWRCSKE AAPDSKYCER HMHRGRNRSR KPVETQLVPP SQPPATAAAS  180
PAAPLAAAAA NGSSFQNHSL YPAIAGSTGG GGGGASNMSS PFSSPLGSSP LHMDNAASYA  240
ALGGTAKDLR YNAYGIRSLA GEHNQLIADA IDSSMENQWR LPPSQNSSFP LSSYPQLGAL  300
SDLGPNTVSS LSKMDRQPLS FLGHDFDSVK QGNQTLRPFF DDWPKARDSW PGRSDDNTNL  360
ASFPATHLSI SIPMASSDFS VASSQSPNDD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953585.10.0PREDICTED: growth-regulating factor 4-like
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLK3YT540.0K3YT54_SETIT; Uncharacterized protein
STRINGSi017449m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-48growth-regulating factor 5